H2N-VRSSSRTPSDKPVAHVVANPQAEGQLQWLNGGK(BIOT)-AMIDE ()

Company information Catalog No Quantity Purity Price*
New England Peptide, LLC BP12-380 1MG USD 300.00

*The above price only for reference

EXPRESS INQUIRY FORM

New England Peptide, LLC

eg: 10 kg
eg: Purity:>98%

Tips

Please enter the mailbox.
1. If the system detects that the email has been registered, you need to enter the password after the first login in order to submit, if the email is not verified, the need for mail authentication.
2. If the email is not registered, you will need to fill out your personal information and in order to confirm the ownership of the email, the system will register as a member of CHEMCD after you submit and send a confirmation email to you, but temporarily send inquiry to suppliers, you need to click on e-mail within 24 hours to verify the link to activate your account, and send the inquiry to the selected suppliers.
3. Sending mail takes time, please wait a moment after you submit.