H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2

CAS No.
107444-51-9
CCD No.
CCD00064264
Formula
C149 H226 N40 O45
MolWeight
3297.66

Basic Information

Product Name: H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2
CAS: 107444-51-9
English Synonyms: GLP-1 (7-36) AMIDE (HUMAN, BOVINE, GP, MOUSE, RAT) ; H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2 TRIFLUOROACETATE SALT ; GLP-1 (7-36), AMIDE, HUMAN ; GLUCAGON-LIKE PEPTIDE 1 (7-36), AMIDE, HUMAN ; GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36*AMIDE HUMAN ; GLUCAGON-LIKE PEPTIDE 1 (7-36)AMIDE ; GLP-1(7~36) ; PREPROGLUCAGON 78-107 AMIDE ; PREPROGLUCAGON (78-107), HUMAN ; GLUCAGON-LIKE PEPTIDE I AMIDE FRAGMENT 7-36 HUMAN ; GLP-1(7-36) ; HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2 ; GLUCAGON-LIKE PEPTIDE 1 (7-36) AMIDE (HUMAN, BOVINE, GUINEA-PIG, MOUSE, RAT) ; GLP-1-(7-36) AMIDE ; HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 ; GLP-1(7-36) AMIDE(HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) ; H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2 ; GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN ; PREPROGLUCAGON (98-127) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT ; GLP-1 (HUMAN, 7-36 AMIDE) ; GLP-1 (7-36) ; GLUCAGON-LIKE PEPTIDE-1 [7-36] ; GLUCAGON-LIKE PEPTIDE 1 (7-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT ; GLUCAGON-LIKE PEPTIDE 1 (HUMAN, 7-36 AMIDE) ; GLP-1 (7-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT ; GLUCAGON-LIKE PEPTIDE I (7-36), AMIDE, HUMAN ; PREPROGLUCAGON (78-107) AMIDE, HUMAN ; GLUCAGON-LIKE PEPTIDE 1 (7-36) AMIDE (HUMAN, RAT) ; GLUCAGON-LIKE PEPTIDE I (7-36), AMIDE, HUMAN, RAT, MOUSE ; PROGLUCAGON (78-107) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT
MDL Number.: MFCD00133373
H bond acceptor: 85
H bond donor: 49
Smile: CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](Cc1c[nH]c2c1cccc2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(=N)N)C(=O)N)NC(=O)[C@H](Cc3ccccc3)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(=O)N)NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](Cc4ccc(cc4)O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](Cc5ccccc5)NC(=O)[C@H]([C@@H](C)O)NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](C)NC(=O)[C@H](Cc6c[nH]cn6)N
InChi: InChI=1S/C149H226N40O45/c1-17-76(10)119(146(232)167-80(14)126(212)175-104(60-86-63-159-91-36-25-24-35-89(86)91)136(222)177-100(56-73(4)5)137(223)186-117(74(6)7)144(230)174-93(37-26-28-52-150)128(214)160-65-110(197)168-92(122(154)208)39-30-54-158-149(155)156)188-138(224)102(57-83-31-20-18-21-32-83)178-133(219)98(47-51-115(204)205)173-132(218)94(38-27-29-53-151)170-124(210)78(12)164-123(209)77(11)166-131(217)97(44-48-109(153)196)169-111(198)66-161-130(216)96(46-50-114(202)203)172-134(220)99(55-72(2)3)176-135(221)101(59-85-40-42-88(195)43-41-85)179-141(227)106(68-190)182-143(229)108(70-192)183-145(231)118(75(8)9)187-140(226)105(62-116(206)207)180-142(228)107(69-191)184-148(234)121(82(16)194)189-139(225)103(58-84-33-22-19-23-34-84)181-147(233)120(81(15)193)185-112(199)67-162-129(215)95(45-49-113(200)201)171-125(211)79(13)165-127(213)90(152)61-87-64-157-71-163-87/h18-25,31-36,40-43,63-64,71-82,90,92-108,117-121,159,190-195H,17,26-30,37-39,44-62,65-70,150-152H2,1-16H3,(H2,153,196)(H2,154,208)(H,157,163)(H,160,214)(H,161,216)(H,162,215)(H,164,209)(H,165,213)(H,166,217)(H,167,232)(H,168,197)(H,169,198)(H,170,210)(H,171,211)(H,172,220)(H,173,218)(H,174,230)(H,175,212)(H,176,221)(H,177,222)(H,178,219)(H,179,227)(H,180,228)(H,181,233)(H,182,229)(H,183,231)(H,184,234)(H,185,199)(H,186,223)(H,187,226)(H,188,224)(H,189,225)(H,200,201)(H,202,203)(H,204,205)(H,206,207)(H4,155,156,158)/t76-,77-,78-,79-,80-,81+,82+,90-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,117-,118-,119-,120-,121-/m0/s1
InChiKey: InChIKey=DTHNMHAUYICORS-KTKZVXAJSA-N

Property

Safety information

WGK Germany: 3