H-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2

CAS No.
123583-37-9 ;126339-09-1
CCD No.
CCD00080885
Formula
MolWeight
0.0

Basic Information

Product Name: H-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2
CAS: 123583-37-9 ;126339-09-1
English Synonyms: PYY (HUMAN, 3-36) ; PEPTIDE YY FRAGMENT 3-36 HUMAN ; PEPTIDE YY (HUMAN, 3-36) ; H-IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 ; PEPTIDE YY(3-36)-PYY-HUMAN ; PEPTIDE YY (3-36) (DOG, MOUSE, PORCINE, RAT) ; H-ALA-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-SER-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2 ; PEPTIDE YY PROTEIN FRAGMENT 3-36 (HUMAN) ; PYY3-36' HUMAN ; PYY 3-36 ; H-ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2 ; PEPTIDE YY (3-36) ; IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 ; PYY (3-36) (HUMAN) ; PEPTIDE YY (3-36), HUMAN ; ILE-LYS-PRO-GLU-ALA-PRO-GLY-GLU-ASP-ALA-SER-PRO-GLU-GLU-LEU-ASN-ARG-TYR-TYR-ALA-SER-LEU-ARG-HIS-TYR-LEU-ASN-LEU-VAL-THR-ARG-GLN-ARG-TYR-NH2
MDL Number.: MFCD00165623
H bond acceptor: 0
H bond donor: 0
InChi: InChI=1S//
InChiKey: InChIKey=MOSFIJXAXDLOML-UHFFFAOYSA-N

Property

Boiling Point: DENSITY: 0.96

Safety information

WGK Germany: 3