About 357 results.

H-GLY-D-TRP-OH

<span class='lighter'>H-GLY-D-TRP-OH</span>

CCD:CCD00043240

CAS:50632-89-8

MDL:MFCD00065278

MF / MW:C13 H15 N3 O3 / 261.28

Synonyms:H-GLY-D-TRP-OH

http://www.chemcd.com/prodetailCCD00043240.html

HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2

HIS-ALA-GLU-<span class='lighter'>GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY</span>-ARG-NH2

CCD:CCD00064264

CAS:107444-51-9

MDL:MFCD00133373

MF / MW:C149 H226 N40 O45 / 3297.66

Synonyms:GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36*AMIDE HUMAN;PROGLUCAGON (78-107) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT;GLP-1 (7-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT;HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2;GLUCAGON-LIKE PEPTIDE I AMIDE FRAGMENT 7-36 HUMAN;GLUCAGON-LIKE PEPTIDE 1 (7-36), AMIDE, HUMAN;GLP-1 (7-36);PREPROGLUCAGON (98-127) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT;GLUCAGON-LIKE PEPTIDE 1 (7-36) AMIDE (HUMAN, BOVINE, GUINEA-PIG, MOUSE, RAT);GLP-1(7-36);GLP-1-(7-36) AMIDE;GLUCAGON-LIKE PEPTIDE 1 (7-36)AMIDE;GLP-1 (7-36), AMIDE, HUMAN;GLP-1(7-36) AMIDE(HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT);GLUCAGON-LIKE PEPTIDE 1 (7-36) AMIDE (HUMAN, RAT);PREPROGLUCAGON (78-107), HUMAN;PREPROGLUCAGON (78-107) AMIDE, HUMAN;GLUCAGON-LIKE PEPTIDE 1 (7-36) AMIDE (HUMAN, BOVINE, GUINEA PIG, MOUSE, RAT) TRIFLUOROACETATE SALT;HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2;GLUCAGON-LIKE PEPTIDE I FRAGMENT 7-36 AMIDE HUMAN;H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2 TRIFLUOROACETATE SALT;GLP-1 (HUMAN, 7-36 AMIDE);GLUCAGON-LIKE PEPTIDE I (7-36), AMIDE, HUMAN, RAT, MOUSE;GLP-1 (7-36) AMIDE (HUMAN, BOVINE, GP, MOUSE, RAT);PREPROGLUCAGON 78-107 AMIDE;GLP-1(7~36);GLUCAGON-LIKE PEPTIDE I (7-36), AMIDE, HUMAN;H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-NH2;GLUCAGON-LIKE PEPTIDE 1 (HUMAN, 7-36 AMIDE);GLUCAGON-LIKE PEPTIDE-1 [7-36]

http://www.chemcd.com/prodetailCCD00064264.html

H-SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-VAL-ALA-LEU-GLY-ALA-PRO-LEU-ALA-PRO-ARG-ASP-ALA-GLY

CCD:CCD00051490

CAS:68893-82-3

MDL:MFCD00081830

Synonyms:PTH (1-84)HUMAN;PTH;PTH (1-84) TRIFLUOROACETATE (HUMAN);PTH (HUMAN, 1-84);H-SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-VAL-ALA-LEU-GLY-ALA-PRO-LEU-ALA-PRO-ARG-ASP-ALA-GLY-SER-GLN-ARG-PRO-ARG-LYS-LYS-GLU-ASP-ASN-VAL-LEU-VAL-GLU-SER-HIS-GLU-LYS-SER-LEU-GLY-GLU-ALA-ASP-LYS-ALA-ASP-VAL-ASN-VAL-LEU-THR-LYS-ALA-LYS-SER-GLN-OH TRIFLUOROACETATE;PARATHORMONE;PARATHYROID HORMONE HUMAN;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE-VAL-ALA-LEU-GLY-ALA-PRO-LEU-ALA-PRO-ARG-ASP-ALA-GLY-SER-GLN-ARG-PRO-ARG-LYS-LYS-GLU-ASP-ASN-VAL-LEU-VAL-GLU-SER-HIS-GLU-LYS-SER-LEU-GLY-GLU-ALA-ASP-LYS-ALA-ASP-VAL-ASN-VAL-LEU-THR-LYS-ALA-LYS-SER-GLN;甲状旁腺激素 人类;PARATHYROID HORMONE (HUMAN, 1-84);PTH, HUMAN;HUMAN PARATHYROID HORMONE;甲状旁腺激素 人类,95%(HPLC)

http://www.chemcd.com/prodetailCCD00051490.html

LYS-THR-TRP-GLY-GLN-TYR-TRP-GLN-VAL|H-LYS-THR-TRP-GLY-GLN-TYR-TRP-GLN-VAL-OH

CCD:CCD08302304

CAS:162558-08-9

Synonyms:LYS-THR-TRP-GLY-GLN-TYR-TRP-GLN-VAL|H-LYS-THR-TRP-GLY-GLN-TYR-TRP-GLN-VAL-OH

http://www.chemcd.com/prodetailCCD08302304.html

TRP-ALA-GLY-GLY-ASP(ALA-SER-GLY-GLU)|H-TRP-ALA-GLY-GLY-ASP(ALA-SER-GLY-GLU-OH)-OH

CCD:CCD08302341

CAS:82602-88-8

Synonyms:TRP-ALA-GLY-GLY-ASP(ALA-SER-GLY-GLU)|H-TRP-ALA-GLY-GLY-ASP(ALA-SER-GLY-GLU-OH)-OH

http://www.chemcd.com/prodetailCCD08302341.html